Skip to main content
SleepCited

Chicken Feather Waste Valorization Into Nutritive Protein Hydrolysate: Role of Novel Thermostable Keratinase From Bacillus pacificus RSA27.

Chhavi Sharma, Svetlana Timorshina, Alexander Osmolovskiy, Jyoti Misri, Rajni Singh
Other Frontiers in microbiology 2022 27 인용
PubMed DOI PDF
<\/script>\n
`; }, get iframeSnippet() { const domain = 'sleepcited.com'; const params = 'pmid\u003D35547122'; return ``; }, get activeSnippet() { return this.method === 'script' ? this.scriptSnippet : this.iframeSnippet; }, copySnippet() { navigator.clipboard.writeText(this.activeSnippet).then(() => { this.copied = true; setTimeout(() => { this.copied = false; }, 2000); }); } }" @keydown.escape.window="open = false" @click.outside="open = false">

Embed This Widget

Style



      
      
    

Widget powered by . Free, no account required.

Study Design

연구 유형
In Vitro
대상 집단
In vitro keratin degradation model
중재
Chicken Feather Waste Valorization Into Nutritive Protein Hydrolysate: Role of Novel Thermostable Keratinase From Bacillus pacificus RSA27. None
대조군
None
일차 결과
Protein hydrolysate production from feathers
효과 방향
Positive
비뚤림 위험
Unclear

Abstract

Microbial keratinases exhibit a momentous role in converting keratin biowastes into exceedingly valuable protein supplements. This study reports a novel, highly stable keratinase from Bacillus pacificus RSA27 for the production of pure peptides rich in essential amino acids from chicken feathers. Purified keratinase showed a specific activity of 38.73 U/mg, 2.58-fold purification, and molecular weight of 36 kDa. Kinetic studies using a chicken feather as substrate report K m and V max values of 5.69 mg/ml and 142.40 μg/ml/min, respectively, suggesting significant enzyme-substrate affinity/biocatalysis. Identification and in silico structural-functional analysis of keratinase discovered the presence of distinct amino acid residues and their positions. Besides, keratinase possesses a high-affinity calcium-binding site (Asp128, Leu162, Asn164, Ile166, and Val168) and a catalytic triad of Asp119, His151, and Ser308, known attributes of serine protease (subtilisin family). Furthermore, a scale-up to 5 L fermenter revealed complete feather hydrolysis (94.5%) within 24 h with high activity (789 U/ml) and total amino acid of 153.97 μmol/ml. Finally, cytotoxicity evaluation of protein hydrolysate resulted in negligible cytotoxic effects (1.02%) on the mammalian hepatoblastoma cell line, signifying its potential biotechnological applications.

요약

A novel, highly stable keratinase from Bacillus pacificus RSA27 is reported for the production of pure peptides rich in essential amino acids from chicken feathers, signifying its potential biotechnological applications.

Full Text

Chicken Feather Waste Valorization Into Nutritive Protein Hydrolysate: Role of Novel Thermostable Keratinase From Bacillus pacificus RSA27

Chhavi Sharma1, Svetlana Timorshina2, Alexander Osmolovskiy2, Jyoti Misri3 and Rajni Singh1*

1 Amity Institute of Microbial Technology, Amity University, Noida, India, 2 Department of Microbiology, Faculty of Biology, Lomonosov Moscow State University, Moscow, Russia, 3 Division of Animal Science, Indian Council of Agricultural Research, New Delhi, India

Edited by: Sanjay Kumar Singh Patel,

Konkuk University, South Korea

Reviewed by: Sunil Kumar Suman,

Indian Institute of Petroleum (CSIR), India

Mohammad Saghir Khan, Aligarh Muslim University, India

*Correspondence:

Rajni Singh [email protected]

Specialty section: This article was submitted to

Evolutionary and Genomic

Microbiology, a section of the journal

Frontiers in Microbiology Received: 24 February 2022 Accepted: 14 March 2022 Published: 25 April 2022 Citation:

Sharma C, Timorshina S, Osmolovskiy A, Misri J and Singh R

(2022) Chicken Feather Waste Valorization Into Nutritive Protein

Hydrolysate: Role of Novel Thermostable Keratinase From

Bacillus pacificus RSA27. Front. Microbiol. 13:882902. doi: 10.3389/fmicb.2022.882902

Microbial keratinases exhibit a momentous role in converting keratin biowastes into exceedingly valuable protein supplements. This study reports a novel, highly stable keratinase from Bacillus pacificus RSA27 for the production of pure peptides rich in essential amino acids from chicken feathers. Purified keratinase showed a specific activity of 38.73 U/mg, 2.58-fold purification, and molecular weight of 36 kDa. Kinetic studies using a chicken feather as substrate report Km and Vmax values of 5.69 mg/ml and 142.40 µg/ml/min, respectively, suggesting significant enzyme-substrate affinity/biocatalysis. Identification and in silico structural-functional analysis of keratinase discovered the presence of distinct amino acid residues and their positions. Besides, keratinase possesses a high-affinity calcium-binding site (Asp128, Leu162, Asn164, Ile166, and Val168) and a catalytic triad of Asp119, His151, and Ser308, known attributes of serine protease (subtilisin family). Furthermore, a scale-up to 5L fermenter revealed complete feather hydrolysis (94.5%) within 24h with high activity (789 U/ml) and total amino acid of 153.97 µmol/ml. Finally, cytotoxicity evaluation of protein hydrolysate resulted in negligible cytotoxic effects (1.02%) on the mammalian hepatoblastoma cell line, signifying its potential biotechnological applications.

Keywords: keratinolytic protease, purification, characterization, structural modeling, scale-up, amino acid production

INTRODUCTION

Feather waste from poultry agro-industries constitutes a major environmental contaminant and accounts for several million tons of highly accumulating recalcitrant waste worldwide (Li, 2019; Mazotto et al., 2022). The disposal of such animal-derived wastes in incinerators or landfills increases both monetary and environmental costs (Wu et al., 2017). Chicken feather shows immense rigidity against physical, chemical, biological agents, and resists proteolysis by proteases like trypsin, pepsin, and papain, which is ultimately a significant obstacle in managing these costs (Qiu et al., 2022). Keratin, a rigid protein with high cysteine and disulfide bonds in β-keratin is the

main component of a chicken feather that contributes to its extreme stability/resistance to degradation (McKittrick et al., 2012; Gupta and Singh, 2014; Nnolim et al., 2020a). Various high energy-consuming, non-eco-friendly thermal and chemical methods are extensively used and explored to decompose and reuse keratin (Li, 2021). But such methods ensue in the loss of some thermosensitive amino acids like tryptophan, lysine, and methionine and add-on to non-nutritive amino acids like lanthionine and lysinoalanine (Lee et al., 2016; Li, 2021).

Keratinases are extracellular-specific proteases capable of degrading keratin (Nigam, 2013; Nnolim et al., 2020a). Hydrolysis of keratinous waste (chicken feather) using microbial keratinase has gained renewed interest as it could be used in the non-polluting processes for environmental cleanup through recycling. Therefore, microbial keratinases have gained significant importance in chicken feather degradation and yield feather-feed rich in amino acids (serine, proline, and cysteine) for value addition as an animal protein supplement (Latha et al.,

  1. 2016; Suman et al., 2018; Li, 2019; Qiu et al., 2022). Research suggests other promising applications of microbial keratinolytic proteases as efficient fertilizers (Singh et al., 2019), along with industrial applicability in peptide synthesis (Verma et al., 2017), therapeutic use (Gupta et al., 2017), biodegradable inexpensive thermoplastics (Jin et al., 2011), detergent, cosmetic, and leather industry (Brandelli, 2008). Thus, microbial decomposition of keratinous waste is a low-expense pivotal approach with no loss of essential amino acids and energy (Gupta and Ramnani, 2006; Brandelli, 2008).
  2. 2017; Hamiche et al., 2019; Nnolim et al., 2020b; Almahasheer et al., 2022; Devi et al., 2022; Mazotto et al., 2022), Aspergillus oryzae (Farag and Hassan, 2004), Paecilomyces marquandii and Doratomyces microsporum (Gradisar et al., 2005), Streptomyces sp. (Tatineni et al., 2008), Stenotrophomonas maltophilia (Cao et al., 2009), Myrothecium verrucaria (Moreira-Gasparin et al., 2009), Thermoactinomyces sp. RM4 (Verma et al., 2016), and Fusarium sp. (Calin et al., 2017). The limitations of existing keratinolytic enzymes constitute their low efficiency on complex feather substrates and low stability (Vidmar and Vodovnik, 2018) and suggest an intensive hunt for novel safe substitutes. Also, expanding the enzyme production process from a laboratoryscale unit to a commercial is challenging as it shows intricacy in evaluating factors such as media components, substrates, and physiological conditions during cultivation. Till date, few scaleup studies have been reported to accomplish almost complete chicken feather degradation (Peng et al., 2019).

Therefore, our research intends to suggest a novel keratinase by Bacillus pacificus RSA27. The enzyme showed distinct activity with high stability within a wide pH and temperature range along with metal ions/inhibitors/surfactants. Our study further reports the successful purification, characterization, and in silico structural-functional analysis of keratinase. As per our knowledge, this is one of the few studies which present keratinase

  1. as a potential alternative for biotransformation of chicken feathers into hydrolysate enriched with high-protein content.

The scale-up of enzyme production was successfully studied in 5L fermenter with complete chicken feather degradation within 24h of cultivation. Henceforth, the research reveals a highly potent/stable keratinase ensuing high-protein content and might serve as an effectual alternative for chicken feather waste management.

MATERIALS AND METHODS Ethical Clearance

Chicken feathers were collected from a small unit of poultry production (Noida, Uttar Pradesh, India) and no live animal or human subjects were sacrificed. We have not used any live material, which could raise any ethical issue, and therefore, the study did not require an ethics review process.

Chemicals and Reagents

All the chemicals and reagents used in the study were purchased from Sigma Aldrich, St. Louis, MO, USA.

Inoculum Source, Culture Conditions, and Production of Keratinase

Keratinase-producing strains were isolated from soil samples (12–15cm deep) collected from a poultry-feather dumping site at Ghazipur (New Delhi, India). Soil samples collected in sterile screw-capped vials were serially diluted and 100 µl of each dilution was spread on a sterilized nutrient agar medium. The plates were kept at 37◦C for 24h. The colony obtained on plates was screened for keratinase production by cultivating it in a sterile media containing peptone (1%), glucose (1%), KH2PO4 (0.9%), and K2HPO4 (0.3%) enriched with a chicken feather (0.5%) as substrate and microbial isolates (1%). Feathers were rinsed with tap water followed by deionized water to remove dust particles and unwanted skin, which were further air-dried at normal room temperature before their addition to the culture medium and autoclaving. The keratinolytic potential of strains was evaluated by incubating the medium containing cultures at temperature 37◦C and 180 rpm for 20 days. The strains were finally screened on the basis of their feather degrading efficiency with respect to time and the highly potent strain was used for further study.

Degradation Rate and Keratinolytic Activity of the Potent Screened Strain

The rate of degradation and keratinolytic activity of the selected isolate was further examined. Unhydrolyzed chicken feathers were harvested at fixed time intervals of 12, 24, 36, and 48h of incubation and filtered through Whatman filter paper 1. These were then thoroughly washed with deionized water to remove culture cells and other soluble materials. The feathers were further oven-dried overnight at 60◦C and the degradation rate of the screened strain was determined [chicken feather degradation (g/L) = dry weight of feathers before degradation—dry weight of feathers after degradation] using analytical laboratory weighing balance. Keratinolytic activity was determined using a chicken feather as substrate. The cell-free extract (after centrifugation at 10,000 rpm for 10min) of keratinase production medium was

used for the assay. The reaction mixture comprised keratinase (100 µl) and glycine-NaOH buffer (4.9ml, 0.5M, pH 9) with chicken feather (0.5%) as substrate was incubated for 1h

  1. at 60◦C. Trichloroacetic acid (4ml of 5%) was employed to stop the reaction. The reaction mixture was filtered and the filtrate was spectrophotometrically measured at 280nm. One unit (U/ml) of keratinase production was defined as an increase in 0.01/h absorbance at 280nm under the assay conditions as described above.

Scanning Electron Microscopy

Feather hydrolysis achieved by selected inoculum was pictured through SEM. The digested feathers were collected at fixed time intervals (0, 24, and 48h) and washed thoroughly with sterile distilled water. The samples were further dried and coated with a thin gold-palladium layer using a gold sputter coater. SEM analysis was executed using Leo 435VP Microscope at an accelerating voltage of 7–21 kV (All India Institute of Medical Sciences, New Delhi, India).

Identification of Microbial Strain

The potent selected isolate inducing chicken feather degradation was then identified for its morphological, biochemical, and molecular characteristics through Bergey’s brochure for identification of bacteriology and 16S rDNA sequencing. Genomic DNA extraction of the strain was performed using a modified phenol-chloroform extraction technique. The ∼1.5kb, 16S-rDNA fragment was amplified using high-fidelity PCR polymerase in DNA Thermal Cycler (Mastercycler pro, Eppendorf). PCR amplification reaction mixture (100 µl) comprised 1 µl of template DNA, 400 ng of 16S forward primer (degenerated 5′ AGAGTTTGATCMTGGCTCAG 3′), 400 ng of 16S reverse primer (degenerated 5′ TACGGYTACCTTGTTACGACTT 3′), 4 µl of dNTPs (2.5mM), 10 µl of Taq DNA Polymerase Assay Buffer (10×), 1 µl of Taq DNA Polymerase Enzyme (3 U/µl), and water. PCR amplification, agarose gel electrophoresis, purification of amplified DNA, and sequencing were performed as per the standardized protocol of Sharma et al. (2020). The obtained sequence was then subjected to a nucleotide blast at NCBI (https://blast.ncbi.nlm.nih.gov) and identified to species level. Evolutionary analyses were conducted through multiple sequence alignment by Clustal Omega and the maximum likelihood method. Bioinformatic tool: Molecular evolutionary genetic analysis software (MEGAX64.exe) was used to create the phylogenetic tree.

Purification of Keratinase

The keratinase from B. pacificus RSA27 was purified through precipitation and chromatographic techniques to procure its purest form. The fermented medium was centrifuged at 6,000 rpm for 30min at 4◦C to remove cell debris. The protein hydrolysate (supernatant) was then treated with chilled ethanol (95%) and incubated at −20◦C overnight. The mixture was centrifuged at 6,000 rpm for 15min to procure the precipitated proteins and further purified using gel filtration chromatography. The proteins were dissolved in phosphate buffer (50mM, pH

7.5) and loaded on Sephadex G-75 column (50 × 15mm), which was pre-equilibrated with Tris-HCL buffer (50mM, pH 7.5). Protein fractions were eluted at a flow rate of 1.0 ml/min with Tris-HCL buffer (50mM, pH 7.5) and assayed for their activity and protein content (Bradford assay). Active fractions were pooled and further purified through ion-exchange chromatography using the Q Sepharose column (65 × 10mm). The column was pre-equilibrated with glycine-NaOH buffer (10mM, pH 9), and pooled active fractions were subjected to the column for purification. Fractions were eluted with a linear gradient of NaCl (0.6M) at a flow rate of 1.0 ml/min. The fractions with keratinolytic activity were pooled, freezedried, and examined for its activity/protein concentration and molecular weight (SDS-PAGE).

Characterization of Keratinase

Effect of pH and Temperature on Activity and Stability of Keratinase

The optimal pH of keratinase activity was determined using different buffers of pH values from 4 to 12. Buffers viz. citrate phosphate for pH 3.0–6.0, Tris-HCL for pH 7.0–8.0, and glycineNaOH for pH 9.0–12.0 were used. The enzyme was incubated for 1h with 0.5% chicken feather as substrate and thereafter assayed for its activity. To evaluate the optimal temperature of enzyme activity, keratinase was incubated for 1h with 0.5% chicken feather as substrate at different temperatures ranging from 20 to 100◦C and thereafter assayed for its activity. Furthermore, we have also evaluated the stability of keratinase at different pH values of 3–12 and temperatures ranging from 20 to 80◦C. The enzyme was preincubated at the aforementioned pH and temperatures for 2h without substrate and then assayed for its activity after every 30min of time interval (30–120 min).

Keratinase Activity in the Presence of Metal Ions, Inhibitors, and Surfactants

The keratinolytic activity of the enzyme in the presence of potential metal ions, inhibitors, and surfactants was evaluated. Metal ions such as Na+, K+, Zn2+, Co2+, Ca2+, Fe2+, Mn2+, Cu2+, Mg2 , and Hg2 and inhibitors such as ethylene-diamine tetra acetic acid (EDTA), β-mercaptoethanol, phenylmethylsulfonyl fluoride (PMSF), urea, indole-3-acetic acid (IAA), N-bromosuccinimide, 1,10-phenanthroline, and dithiothreitol (DTT) of 2 and 5mM concentration were used. Besides, the effects of various (1 %) surfactants viz. saponin, sodium cholate, sodium dodecyl sulfate (SDS), Tween 80, and Triton X 100 on enzyme activity were also studied. The keratinase was preincubated for 1h with the aforementioned chemical reagents and then assayed for its activity at optimal pH of 9 and temperature of 60◦C. The sample without any chemical reagent was treated as a control.

Enzyme Kinetics

GraphPad Prism 9.0 Ink was used to evaluate kinetic parameters (Km and Vmax) of keratinase using non-linear regression, Michaelis-Menten curve with various concentrations of a chicken feather as substrate (0.5–5.0 mg/ml). The experiments were conducted under optimum temperature and pH conditions.

Ker Gene Sequencing and Keratinase Prediction

The identification of gene (ker) responsible for the production of keratinase was identified through sequencing. Forward primer 5′-AAAAGGAGAGGGTAAAGAGT-3′ and reverse primer 5′-AGCAGGTATGGAGGAGCCTG-3′ were used for PCR amplification. Amplification reaction, gel electrophoresis, and sequencing were performed as per the standardized protocol of Gupta et al. (2017). Bioinformatics tool ExPASY (http://web.expasy.org/translate) was used to translate the obtained ker gene sequence into the amino acid sequence to further get an insight into the potent keratinase responsible for feather degradation. The deduced sequence was analyzed using PSI-BLAST (https://blast.ncbi.nlm.nih.gov/Blast.cgi? PAGE=Proteins), aligned using CLUSTAL W (http://www.ebi. ac.uk/clustalw) for the identification of conserved residues and sequence logos were generated using WebLogo 3.7.4 program (http://weblogo.threeplusone.com/) for a clear alignment of identified conserved domains.

Structural Modeling and in vitro Validation

The three-dimensional (3D) structure of keratinase was predicted using homology modeling tools—Swiss-model (https://swissmodel.expasy.org/) and Phyre2 (http://www.sbg. bio.ic.ac.uk/phyre2). Modeling server Swiss-model predicted one calcium-binding site (Ca1) of keratinase, which was visualized using Ligplot+ version 2.2 (https://www.ebi.ac.uk/thornton-srv/ software/LigPlus/). In vitro validation evaluating the effect of Ca ions on the thermostability of keratinase was further studied by incubating keratinase for 2h with 5mM of CaCl2 at different temperatures (20–80◦C). Keratinolytic activity was performed as per our standard protocol. A reaction mixture without CaCl2 served as a control.

Scale-Up in a Laboratory 5-L Batch Fermenter

The in vitro feather degradation was scaled up in a 5L continuous stirred tank bioreactor (Biostat-B-Lite, Laboratory fermenter system, Sartorius, Germany). A total of 3L of optimized media was sterilized and inoculated with 2% of overnight grown culture and 0.5% chicken feather waste. The fermentation was carried out for 24h at 37◦C at 180 rpm agitation, uncontrolled pH, and sterile air with a constant rate of 2 vvm. Samples were withdrawn at fixed intervals (2h) and analyzed for keratinase production and change in pH with respect to time. The fermentation parameters such

  1. as temperature, pH, and airflow were continuously monitored throughout the process.

Amino Acid Profiling

The amino acid profiling of B. pacificus RSA27 keratinase was accomplished using cell-free extract of digested feathers in triplicates at the time interval of 0, 12, and 24h using high-performance chromatography (Agilent 1100 HPLC, Santa Clara, United States) and was performed as per the standardized protocol of Gupta and Singh (2014).

In vitro Cytotoxicity Evaluation of Protein Hydrolysate

Cell-free supernatant 0.09–50% (v/v) of digested feathers was analyzed for cytotoxicity using mammalian hepatoblastoma cell line HepG2 (8 × 103 cells/well). Doxorubicin hydrochloride (0.10–5.00µM) and untreated cells served as positive and negative controls, respectively. The cells were then incubated at 37◦C for 72h, and cytotoxicity was assessed using MTT [3-(4,5dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide] assay. MTT (20 µl of 5 mg/ml) was added to each well and incubated for 3h at 37◦C. The supernatant was aspirated and dimethyl sulfoxide (150 µl) was added to each well to dissolve formazan crystals. Microplate reader (BioTek Winooski, VT, USA) was used to measure absorbance at 540nm, and cytotoxicity (%) was determined.

RESULTS AND DISCUSSION Chicken Feather Degradation Rate of Keratinase

In total, 44 strains out of the 200 isolates exhibited keratinolytic ability. Out of which feather degradation with 24 strains was observed in 15–20 days, 19 strains in 5–10 days, and 1 strain in 2 days. The highest feather degrading capacity was observed with isolate RSA27, which initiated the fastest feather degradation within 24h and completely degraded feather within 48h of incubation at 180 rpm and temperature 37◦C (Figure 1A). The breakdown of a chicken feather was visualized using SEM after 0, 24, and 48h of incubation. Incubation for 24h resulted in degradation of feather barbs, whereas calamus degradation was observed after 48h of incubation, leading to a complete breakdown of chicken feathers (Figure 1B). A similar result was reported by Gupta and Singh while estimating chicken feather hydrolyzing ability of two Bacillus subtilis strains E163 and E165 after 24, 48, and 72h of cultivation (Gupta and Singh, 2014). In another study, keratinase from B. subtilis 8 resulted in a complete breakdown of the chicken feather-shaft structure within 48h when analyzed and identified through SEM (He et al., 2018). A significant decrease in the weight of chicken feathers hydrolyzed by RSA27 was observed with the increase in incubation time (0–48h). The observed residual weight (g) was 4.17, 3.39, 1.95, and 0.1 after incubation of 12, 24, 36, and 48h, respectively. Complete feather degradation was observed after 48h of incubation (Figure 1C). The keratinolytic activity of RSA27 strain after 48h was found to be 125.10 U/ml.

Identification of Keratinolytic Strain

The isolate RSA27 morphologically exhibited non-translucent, white, and circular (2–3mm in diameter) colonies. It was observed as non-motile, rod-shaped, and gram-positive Bacillus strain. Biochemical characterization imparted its positive catalase, gelatinase, and oxidase activities. Results were positive for citrate utilization, Voges-Proskauer test, and arginine dihydrolase while negative for lysine decarboxylase, βgalactosidase, H2S, indole, and acid production from arabinose, amygdalin, mannitol, sorbitol, sucrose, glucose, rhamnose, inositol, and melibiose. Such phenotypic and biochemical

specifications were similar to strain B. pacificus EB422T of Bacillus cereus group (Liu et al., 2017). So, the strain was further confirmed and identified as B. pacificus RSA27 (NCBI Accession number MT180833.1) by 16S rDNA sequencing. Phylogenetic analysis by maximum likelihood methodology conveyed details about the distinct position and evolutionary association of B. pacificus RSA27 with other Bacillus strains (Supplementary Figure 1).

with a yield of 54.48% relative to crude keratinase by Q Sepharose (Table 1). A specific activity of 38.73 U/ml was assessed for the ultimate keratinase. The molecular weight of ∼36 kDa was analyzed by SDS-PAGE (Figure 2). Literature reports numerous keratinolytic enzymes of apparently similar molecular weight of 35 kDa from Bacillus licheniformis (Suntornsuk et al., 2005), 42 kDa from Microbacterium sp. (Thys and Brandelli, 2006), and 44 kDa from Streptomyces sp. (Tatineni et al., 2008).

Purification

Purification of keratinase through chilled ethanol precipitation and Sephadex G-75 column resulted in 75.02% yield with 1.25fold purification and 54.48% yield with 2.05-fold purification, respectively. Furthermore, the enzyme was 2.58-fold purified

Characterization of Keratinase

Activity and Stability of Keratinase Under Varied pH and Temperature

We have further quantified the keratinase activity and stability to evaluate enzymatic hydrolysis within wide pH and temperature

  1. TABLE 1 | Purification parameters of keratinase from Bacillus pacificus RSA27.

Purification steps Total activity (U/mL) Total protein (mg/mL) Specific activity (U/mg) Yield (%) Fold purification

Crude enzyme 125.10 ± 5.21 8.34 ± 0.52 15.00 ± 1.09 100 1 Ethanol precipitation 93.85 ± 3.76 4.99 ± 0.31 18.81 ± 1.21 75.02 1.25 Sephadex G-75 68.15 ± 3.11 2.21 ± 0.17 30.84 ± 1.17 54.48 2.05 Q Sepharose 64.29 ± 2.86 1.66 ± 0.09 38.73 ± 1.24 51.39 2.58

range. Keratinase exhibited 100% enzymatic activity with a chicken feather as substrate (0.5%) at pH 9 (Figure 3A). The keratinase retained its full stability (100%) at pH 9 even after 2h of incubation, while a slight reduction in activity was observed from pH 3 to 8 and pH 10 to 12 (Figure 3C). Most of the reported proteases are alkaline in nature and thus beneficial for various biotechnological applications (Rahman et al., 2005; Verma et al., 2016; Pandey et al., 2019; Sharma et al., 2020). Our results are in resemblance with some other previous studies as well, which again suggests that alkaline pH alters cysteine residues to lanthionine and aids in keratinolytic activity with high industrial applicability (Rissen and Antranikian, 2001; Selvam et al., 2013). Also, B. pacificus RSA27 originated keratinase is stable even under acidic conditions (pH 3–6) with no major loss in activity, suggesting its utilization as an animal feed supplement, which can retain its functionality even after passing through the mammalian digestive system (Wu et al., 2017). Research supports the vision of the use of biowastes as feed, which makes the process economical (Patel et al., 2021).

The temperature profile of keratinase demonstrates optimum activity at 60◦C (100%) with wide stability within 20–80◦C (Figure 3B). The enzyme showed 100% stability at 20◦C and a slight reduction in activity of 98.84, 97.97, 96.69, 90.98, 81.92, and 80.59% with an increase in temperature from 30 to 80◦C, correspondingly (Figure 3D). Our results were in contrast with

some earlier reports where after 2h of incubation, keratinase of Thermoactinomycetes sp. showed 100% stability at 70◦C (Verma et al., 2016). Another keratinase rMtaker was also found stable at 70◦C after 2h of incubation (Wu et al., 2017). Also, as mentioned, the maximum activity of our keratinase was observed at 60◦C (with substrate) and full stability at 20◦C (without substrate). Hence, it becomes necessary to mention here that the presence of protein substrates (here chicken feather) tend to increase the thermostability and activity of heated enzymes. A similar phenomenon was reported and discussed in other studies as well (Chang and Mahoney, 1995; Wu et al., 2017).

Keratinase Efficacy in the Presence of Metal Ions, Inhibitors, and Surfactants

Bacillus pacificus RSA27 derived keratinase was treated with different potential metal ions/inhibitors (2 and 5mM) and surfactants (1%), and the activity was measured using a chicken feather as substrate. Keratinase activity was significantly enhanced in the presence of monovalent viz. Na+ and K+ and divalent metal ions viz. Mn2 , Fe2 , Mg2+, Cu2 , and Ca2 , at both the assayed concentrations. An activity increase of 32.84, 36.85, 42.54, 29.58, 18.59, 45.99, and 47.01% was observed in the presence of 5mM concentration of Na+, K+, Mn2+, Fe2+, Mg2+, Cu2+, and Ca2+, respectively. Such an outcome suggests the requirement of these metal ions for optimal activity of the

enzyme (Patel et al., 2019, 2022; Kondaveeti et al., 2022). Besides, slight inhibition with 86.24% of keratinase activity was observed

  1. at low concentration (2mM) while a slight increase of 10.32% in activity was testified at high concentration (5mM) of metal ion Co2+. On the contrary, an increase of 7.51 and 3.58% in enzyme activity was observed at low concentration of Zn2+ and Hg2+, respectively. However, when used in high concentration, Zn2+ and Hg2+ resulted in the slight inhibition of keratinase activity (Figure 4A). Our results are in contrast to some previous research reports where no significant effect on keratinase activity was observed with monovalent ions (Na+, Li , and K+; Jaouadi et al., 2013). However, results similar to our study were reported by Verma et al. (2016) wherein some remarkable activity of keratinase from Thermoactinomycetes sp. RM4 was observed in the presence of monovalent ions Na+ and K+. Another study by Yong et al. (2020) detailed the stimulation of keratinase activity with Mg2+ and Ca2+ and complete inhibition by Cu2+. Our study also reports high keratinase activity at both concentrations of Ca2+, which is normally considered a standard attribute of serine proteases (Yong et al., 2020). Furthermore, inhibition inactivity of keratinase from Bacillus subtilis K-5 was observed with metal ions Na+, K+, Zn2+, Mn2+, Hg2+, Cu2+, and Ca2+ (Singh et al., 2014).

The keratinase was found to be serine protease in nature, as the presence of both high and low concentrations of PMSF resulted in complete loss of keratinase activity. Keratinase activity of 3.07% and 0.09% was observed with 2 and 5mM of serine protease inhibitor PMSF, respectively. Also, with the increase in the concentration of inhibitors viz. N-bromosuccinimide, 1,10phenanthroline, EDTA, IAA, and urea, the activity of keratinase gradually decreased. No significant decrease in enzyme activity was observed with DTT and mercaptoethanol at their respective concentrations (Figure 4B). BsKER71 keratinase by Bacillus subtilis S1-4 was also strongly inhibited by PMSF and reported as serine protease (Nnolim et al., 2020b). Similar observations were stated from keratinases of Brevibacillus brevis US575 (Jaouadi et al., 2013) and Aspergillus parasiticus (Anitha and Palanivelu,

2013). Also, studies have shown that metalloprotease inhibitors (EDTA and 1,10-phenanthroline) might slightly inhibit the catalytic activity of some serine proteases, which recommends the requirement of transition metals for their hydrolysis (Nnolim

  1. et al., 2020b). However, a significant increase in keratinolytic activity was
  2. et al., 2021). Another research on alkaline protease reports

Km and Vmax values of 7.0 mg/ml and 54.30 µmol/ml/min, respectively (Mushtaq et al., 2012).

Ker Gene Sequencing and Prediction of Keratinase Sequence

The ker gene sequence study revealed the presence of 1,197 bp nucleotides encoding for 399 amino acids (Supplementary Figure 2). The longest reading frame (362 amino acids) from position 26 to 387 was chosen for further in silico analysis and is mentioned underneath.

MAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKD VISEKGGKVQKQFKYVNAAAATLDEKAVKELMIPADLGKK GADRPIIKGAQSVPYGISQIKAPALHSQGYTGSNVKVAVIDS GIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAA LNNSIGVLGVAPSASLYAVKVLDSTGSGQYSWIINGIEWAIS NNMDVDASKENATFGHINSAQANDPSVSSGIVVAAAAGN EGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELD VMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSK HPTWTNAQVRDRLESTATYLGSSFYYGKGLINVQAAAQ

Prosite search revealed that keratinase belongs to the subtilase family (serine protease) showing three distinct active sites 115VAVIDSGIdssH126 (Asp active site), 151HGThVAGtIAA161 (His active site), and 306GTSmAtPhVAG316 (Ser active site). Further, PSI-BLAST depicted that the top 10 homologous enzymes were used for conserved domain analysis of keratinase. Subtilisin AprE enzymes from Bacillus (WP_041335567.1 and WP_017695350.1) with a maximum score of 631, a total score of 631, query cover of 100%, e-value of 0, the identity of 90.06%, and length of 381 were detected with maximum sequence homology with keratinase. Additionally, moderate sequence

similarity was observed with keratinase from Bacillus subtilis (AIY62812.1) with a maximum score of 630, a total score of 630, query cover of 100%, e-value of 0, the identity of 90.06%, and length of 362. A clear alignment of Clustal Omega identified that conserved domains were generated using Weblogo. Results indicate that six large stretches of highly conserved domains in homologous regions were observed from positions (Gln28Lys65, Gln67-Leu88, Ala107-Pro146, Leu148-Asp226, Val249-Ser297,

and Gly299-Ala336) and low keratinase conserved amino acids at Met89-Ala99, Arg100-Gly106, Asp228-Phe236, His238Asn245, Pro247, and Ser248 (Figure 6; Supplementary Figure 3). Alignment of a novel keratinase KerUS from Brevibacillus brevis US575 with homologous enzymes revealed distinct keratinase residues in the mature region at Glu13, Lys51, Ala65, Ser87, Asp104, Pro129, Asn130, Phe159, Thr162, Asp172, Gly175, Ser182, Asn186, Ala219, Val233, Tyr238, Thr242, and Asn243 (Jaouadi et al.,

  1. TABLE 2 | Chicken feather degradation in 5L fermenter depicting change in keratinase activity and pH in reaction system with due course of time.
  2. TABLE 3 | The concentration of amino acids detected in feather hydrolysate after 12 and 24h of degradation.

Amino acid Concentration (µmol/mL) 0 h 12 h 24 h

Aspartic acid 0.29 ± 0.06 0.41 ± 0.05 0.71 ± 0.07 Glutamic acid 2.94 ± 0.17 3.73 ± 0.22 3.13 ± 0.25 Serine 4.48 ± 0.51 5.52 ± 0.81 5.46 ± 0.21 Histidine 0.51 ± 0.05 0.57 ± 0.05 0.62 ± 0.04 Glycine 14.97 ± 0.84 12.75 ± 0.80 12.51 ± 0.97 Threonine 3.62 ± 0.25 3.81 ± 0.19 3.95 ± 0.62 Alanine 16.27 ± 0.27 14.92 ± 0.75 14.06 ± 0.47 Arginine 1.32 ± 0.09 1.48 ± 0.11 1.92 ± 0.10 Tyrosine 5.29 ± 0.21 9.34 ± 0.44 26.87 ± 0.47 Valine 2.16 ± 0.13 7.13 ± 0.16 14.55 ± 0.81 Methionine 12.25 ± 0.87 15.49 ± 0.70 28.45 ± 0.69 Phenylalanine 1.15 ± 0.07 1.61 ± 0.08 3.78 ± 0.37 Isoleucine 3.41 ± 0.14 5.20 ± 0.41 9.56 ± 0.25 Leucine 4.99 ± 0.60 8.35 ± 0.73 14.10 ± 0.41 Lysine 6.88 ± 0.81 7.96 ± 0.18 9.31 ± 0.25 Cysteine 2.41 ± 0.09 3.10 ± 0.21 4.99 ± 0.20 Proline ND ND ND Tryptophan ND ND ND Glutamide ND ND ND Asparagine ND ND ND

2013). Another study of a novel thermostable keratinase from Deinococcus geothermalis reports numerous conserved residues along with four conserved stretches from Asp163-Ile166, Gly195Thr203, Asn252-Gly257, and Gly346-Met349 (Tang et al., 2021). The outcomes thus suggest that keratinase exhibits no absolute similarity with already reported Bacillus sp. protein and is a novel keratinolytic enzyme with significant feather hydrolysis potential.

Structural Modeling and in vitro Validation

Swiss-model modeled keratinase structure with GMQE (0.86) and QMEAN (−2.01) and predicted 88.86% identity with

“3whi.1.A” (subtilisin E, Crystal structure of unautoprocessed form of IS1-inserted pro-subtilisin E; Figure 7A). Besides, another modeling server Phyre2 predicted keratinase structure with 100% confidence, 96% coverage, and 89% identity with template “c3whiA” (Figure 7B). The modeled keratinase was found to exhibit Ca1 (calcium-binding site) and amino acid residues Asp128, Leu162, Asn164, Ile166, and Val168 were present amid 4 Å for ligand contacts (Figure 7C). Subtilisin enzymes from Bacillus sp. have two high-affinity Ca1 and low-affinity Ca2binding sites, which have (specifically Ca1) aids in protection against autolysis and thermal stability (Sharma et al., 2021a,b). Our in silico study supports the in vitro characterization results wherein an increase in activity was observed in the presence of CaCl2 (2/5mM). The effect of Ca ions on thermostability was further analyzed to draw conclusive results. A significant increase of 68.65, 60.94, 50.98, 40.64, 33.29, 29.12, and 18.58% was examined in the presence of CaCl2 (5mM) at temperatures 20, 30, 40, 50, 60, 70, and 80◦C, respectively, thus validating our in silico outcome (Figure 7D). Enhanced thermostability of proteases M179 and AprE176 from Bacillus subtilis HK176 was accessed with Ca ions wherein M179 retained 36% of its activity after 5h at 45◦C while AprE176 retained 11% activity (Jeong et al., 2015). RFEA1 from B. cereus RSA1 showed 30.87% of increase in its activity in the presence of CaCl2 and an increased thermostability of 10.58, 21.12, 26.71, 30.17, 36.98, 41.25, and 45.65% at temperatures 80, 70, 60, 50, 40, 30, and 20◦C, respectively (Sharma et al., 2021a). In another study, Bacillus subtilis DC27-produced enzyme was reported with enhanced activity (122.02 ± 5.71%) in the presence of 5mM Ca ions (Hu et al., 2019).

Model-template alignment revealed that stretch of residues from Met1 to Gly12 is lacking in the template with respect to keratinase and from Tyr77 to Gln89 is lacking in keratinase with respect to the template. Besides, a large number of dissimilar residues (Met70-Ala80, Arg82-Lys86, Gly87, Ala172, Asp209-Phe217, His219-Asn216, Pro228, Ser229, Ser308, and Ser346) were reported in keratinase in comparison to a template. Additionally, huge dissimilarity in positions of residues was observed amid keratinase and its template (Figure 7E). Research suggests that despite high identity, homologous enzymes might exhibit distinct residues and lack some stretches of amino acids (Sharma et al., 2021a).

Scale-Up and Amino Acid Profiling

Scale-up to a 5L fermenter was performed to improve efficiency and outstretch the broad industrial conditions of chicken feather hydrolyzing novel B. pacificus RSA27 isolate. Predictably, all chicken feathers degraded within 24h of inoculation with a degradation rate of 94.5% and left with the remaining 0.825g undecomposed feather in the culture, which is extremely difficult to decompose. Keratinase production started within 2h of culture and retained its maximum activity (789.00 U/ml), which was 6.31-fold increment than the original activity (125.01 U/ml). A gradual increase in pH (9.20) was observed with respect to time (Table 2). Besides, the scaleup cultivation in a 5L bioreactor has led to an increase in efficiency of feather hydrolysis by lowering degradation

  1. TABLE 4 | Cytotoxicity evaluation of protein hydrolysate (0.09 50%) using MTT assay in HepG2 cells.

Compound Concentration Cytotoxicity (%)

Positive control (doxorubicin hydrochloride) 0.10µM 49.10 ± 2.19 1.00µM 75.62 ± 2.67 5.00µM 81.52 ± 3.72

Protein hydrolysate (cell-free supernatant) 0.09% 1.02 ± 0.08

  1. 0.25% 2.51 ± 0.06
  2. 1.00% 4.60 ± 0.14
  1. 1.75% 10.20 ± 0.53
  2. 2.50% 18.29 ± 0.83 5.00% 21.29 ± 0.99

10.00% 35.21 ± 1.59 25.00% 59.21 ± 2.65 50.00% 61.29 ± 2.36

time to 24h, which is half the degradation time in 100-ml Erlenmeyer flasks. Therefore, such large-scale optimization using novel B. pacificus RSA27 exhibits significant potential for industrial poultry feather waste degradation. In recent research, 81.8% rate of chicken feather degradation was observed in a 3-L fermenter and an increase in chicken feather degrading efficiency was accomplished by reducing the degradation time to half the actual time (Peng et al., 2019). Bioreactor scale-up of enzyme production has also been performed and reported in many other previous reports, wherein Ni et al. (2011) stated five-fold increase in keratinase production in 5L bioreactor using optimized medium. Similarly, Fang et al. (2013) has observed enhanced production of keratinase in fed-batch conditions using keratin waste (117.7%).

The hydrolyzed chicken feather consists of protein βkeratin (91%), which was analyzed through high-performance liquid chromatography at the time intervals of 12 and 24h of the degradation process. The concentration of hydrolyzed sample (12 and 24h) is depicted in Table 3, wherein the total composition of amino acids was observed 153.97 µmol/ml after 24h of hydrolysis. An increase in the concentration of aspartic acid (2.45-fold), tyrosine (5.08-fold), valine (6.74-fold), methionine (2.32-fold), phenylalanine (3.29-fold), isoleucine (2.80-fold), leucine (2.82-fold), lysine (1.35-fold), and cysteine (2.07-fold) was observed over the period of time taken for complete degradation (24h). The obtained amino acid concentrations are greater than those stated previously (Jeong et al., 2010; Fang et al., 2013; Ramakrishna et al., 2017; Peng et al., 2019; Supplementary Table 1). Tyrosine, leucine, valine, and phenylalanine are essential amino acids that cannot be synthesized in the body. Also, sulfur-containing methionine and cysteine along with tyrosine, phenylalanine, and threonine are important for feather and hair keratin synthesis, whereas amino acid arginine contributes to cats’ urea cycle. Hydrolyzed chicken feathers thus have a prodigious potential to produce amino acids, which can be further utilized as animal protein supplements (Peng et al., 2019).

Cytotoxicity of Protein Hydrolysate on Mammalian Cell Lines

Metabolism of nutrients and digestives (amino acids, glucose, and fatty acids) is performed by liver tissue, which encompasses essential enzymes for such requisite functions (Sadi et al., 2015). Also, hepatocellular carcinoma (liver cancer) is a major global concern and therefore HepG2 cells were used for in vitro cytotoxicity evaluation of hydrolyzed feathers. Furthermore, cytotoxicity evaluation of an enzyme is extremely important for its commercialization/applicability, and limited attempts are scientifically reported in this regard. Our cytotoxicity data revealed that in in vitro conditions 0.09% of protein hydrolysate has very less/negligible cytotoxicity (1.02%), whereas an increase in toxicity was observed at higher concentrations (Table 4). As a hydrolyzed feather at 0.09% concentration exhibited negligible cytotoxic effect as compared to the positive control, it might be explored as an efficient fertilizer and animal feed supplement at low concentrations along with several industrial applications. However, in vivo animal modeled examination is essential to assess any allergic or immunomodulatory reaction of the hydrolyzed feather.

CONCLUSION

Agro-environmental organic waste valorization to beneficial produce is highly essential for sustainable development and has extensively nurtured the bio-economy worldwide. Henceforth, keratinase by B. pacificus RSA27 is a novel and efficient ecofriendly alternative for bio-converting chicken feathers into nutritive protein hydrolysate. Scanning electron microscopy has evidently displayed the keratinase potential of chicken feather hydrolysis pattern over time. The protease showed significant keratinolytic activity even at extreme temperature (20–80◦C) and pH range (3–12). Here, observations suggest that the keratinase will retain its activity even in the mammalian digestive tract as there is no major loss in its activity even at extreme acidic conditions of pH 3–6. Also, the protease showed significant activity with divalent/monovalent metal ions and surfactants, imperative for optimum production/utility. The keratinase was observed as a serine protease with complete activity inhibition with PMSF (0.09%). Km and Vmax values of 5.69 mg/ml and 142.40 µg/ml/min indicate significant enzymesubstrate affinity/biocatalysis. Deduced sequence/structural analysis confirms its novelty with distinct residues, active sites, and high-affinity Ca1-binding site (at diverse positions) when compared with homologous enzymes. Scale-up revealed complete feather hydrolysis with significant activity (789 U/ml) and protein content (153.97 µmol/ml), indicating its substantial use in numerous biotechnological applications. Conclusively, effectual feather degradation by novel keratinase supports the prospective of recalcitrant keratinous waste valorization into valuable produce.

PDF
Loading PDF...

Figures

Used In Evidence Reviews

Similar Papers